Specialtyfinancialservicesllc.com
SEO Site Score, overview, meta information, keywords consistency, whois data, backlinks counter, usability, page insights, mobile friendliness, speed tips for Specialtyfinancialservicesllc.com
SEO Site Score, overview, meta information, keywords consistency, whois data, backlinks counter, usability, page insights, mobile friendliness, speed tips for Specialtyfinancialservicesllc.com
<H1> | <H2> | <H3> | <H4> | <H5> | <H6> |
---|---|---|---|---|---|
1 | 2 | 7 | 3 | 0 | 0 |
<H1> Tax Prepare | Specialty Financial Services LLC </H1> |
<H2> Our Services </H2> |
<H2> Contact Us </H2> |
Tax Prepare | Specialty Financial Services LLC
specialtyfinancialservicesllc.com/
Specialty Financial Services llc, We are an organization based in the United States. Our serevices Tax prepare USA, Tax refund, Credit Repair, Insurance, Investment, Mortgages, Business and Personal loans, PPP 10K Grant, SBA Loan, PUA Benefit. We are always ready to cooperate financially.
https://static.wixstatic.com/media/14325c_92e8b5b0b2374525a0dae3ea64ed539d~mv2.jpg/v1/fill/w_480,h_270,al_c,q_80,usm_0.66_1.00_0.01,blur_2/14325c_92e8b5b0b2374525a0dae3ea64ed539d~mv2.jpg |
https://static.wixstatic.com/media/14325c_2f58b9f8c6654ca799db3f6edb684715~mv2.jpg/v1/fill/w_116,h_116,al_c,q_80,usm_0.66_1.00_0.01,blur_3/14325c_2f58b9f8c6654ca799db3f6edb684715~mv2.jpg |
https://static.wixstatic.com/media/14325c_53af61f44a4c4a778dd2de4575b19e53~mv2.gif |
Text content size | 1160 bytes |
Total HTML size | 565087 bytes |
Domain Age: 0 Years, 245 Days
Created Date: 25th-Nov-2020
Updated Date: 25th-Nov-2020
Expiry Date: 25th-Nov-2022
Domain Name: SPECIALTYFINANCIALSERVICESLLC.COM |
Registry Domain ID: 2574523439_DOMAIN_COM-VRSN |
Registrar WHOIS Server: whois.wix.com |
Registrar URL: http://www.wix.com |
Updated Date: 2020-11-25T16:34:25 |
Specialtyfinancialservicesllc.com desktop website speed is fast. Page speed is important for both search engines and visitors end.
Domains (TLD) | Status |
---|---|
specialtyfinancialservicesllc.net | Available |
specialtyfinancialservicesllc.org | Available |
specialtyfinancialservicesllc.biz | Already Registered |
specialtyfinancialservicesllc.io | Already Registered |
specialtyfinancialservicesllc.info | Available |
Domains (TLD) | Status |
---|---|
specialtyfinancialserviceslc.com | Available |
qpecialtyfinancialservicesllc.com | Available |
wpecialtyfinancialservicesllc.com | Available |
epecialtyfinancialservicesllc.com | Available |
zpecialtyfinancialservicesllc.com | Available |
Specialtyfinancialservicesllc.com mobile website speed is slow. Page speed is important for both search engines and visitors end.
Server IP | Server Location | Service Provider |
---|---|---|
specialtyfinancialservicesllc.com | United States | Wix.com Ltd. |
Anchor | Type | Follow |
---|---|---|
https://www.specialtyfinancialservicesllc.com/ | Internal Links | Dofollow |
Home | Internal Links | Dofollow |
SERVICES | Internal Links | Dofollow |
TAX PREPARATION | Internal Links | Dofollow |
INCOME PROTECTION | Internal Links | Dofollow |
Social
Social Data
Cost and overhead previously rendered this semi-public form of communication unfeasible.
But advances in social networking technology from 2004-2010 has made broader concepts of sharing possible.